General Information

  • ID:  hor005650
  • Uniprot ID:  Q9DG36
  • Protein name:  Gonadoliberin-2
  • Gene name:  gnrh2
  • Organism:  Lithobates catesbeianus (American bullfrog) (Rana catesbeiana)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  Expressed at significantly higher levels during hibernation and post-breeding. Not expressed in pituitary. |Midbrain and hindbrain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lithobates (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0000003 reproduction; GO:0009755 hormone-mediated signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSHGWYPG
  • Length:  10
  • Propeptide:  MACQRHLLFLLLVLFAVSTQLSHGQHWSHGWYPGGKRELDMPASPEVSEEIKLCEGEECAYLRNPRKNLLKNILGRSNQKKNADVLARQLQKK
  • Signal peptide:  MACQRHLLFLLLVLFAVSTQLSHG
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9DG36-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005650_AF2.pdbhor005650_ESM.pdb

Physical Information

Mass: 141504 Formula: C60H71N17O14
Absent amino acids: ACDEFIKLMNRTV Common amino acids: GHW
pI: 7.71 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -162 Boman Index: -1186
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 2043 Extinction Coefficient cystines: 12490
Absorbance 280nm: 1387.78

Literature

  • PubMed ID:  11170016
  • Title:  Cloning and characterization of cDNAs encoding the GnRH1 and GnRH2 precursors from bullfrog (Rana catesbeiana)